PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK08671.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 745aa    MW: 84753.3 Da    PI: 4.7536
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK08671.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS365.29.3e-1123717421373
       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                l++lL+ cA+avss+d + a ++L+++++++sp+gd  qRla++f+++L arla+ +++  + + ++  ++ + s+ l+a++l   ++P+ k++ + aN+
  PK08671.1 371 LRTLLILCAQAVSSDDRRTAYEILKQIRQHSSPNGDGSQRLAHFFANGLDARLAGIGTG--ALFYSNLLANVKASDLLKAYHLNLSTCPFKKMAMFFANK 468
                5789***************************************************5554..4466667776789************************** PP

       GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                +I++ +e+++++Hi+Df+i +G+QWp ++q L++R++gpp+lRiTg++ p++g   k+++eetg+rL+k++e++gvpf++n++++k+++++++e++++++
  PK08671.1 469 MIMQVAEKATTLHIVDFGILYGFQWPIFIQYLSKRDGGPPNLRITGIEFPQNGfrPKQRIEETGRRLTKYCERFGVPFRYNAIATKNWDCISVEDIEIES 568
                ****************************************************9*********************************************** PP

       GRAS 199 gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvv 298
                +E++aVn+ ++  ++l+e+v+    rd+vL+l+++++P+++v    + ++n++ F++rf e + ++sal+d+l++++++e+eer ++Ere+ greivnv+
  PK08671.1 569 NEVVAVNCLMRFNNVLEETVENCP-RDAVLRLIRKINPTIFVNNIVNGSYNAPFFVTRFRELMFHFSALLDMLDTNVSKENEERLMYEREFYGREIVNVI 667
                ****************88888777.*************************************************************************** PP

       GRAS 299 acegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                aceg++r+er et+++W+ r  +aGF+++pl+++++ + k  lr+ + + ++++e+ +++++gWk+r ++++S+W
  PK08671.1 668 ACEGEDRVERPETYKQWHVRSLRAGFRSLPLDQEIMGKFKDKLRTWYHKDFEIDEDTNWMLQGWKGRIVYATSCW 742
                ***********************************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.176345723IPR005202Transcription factor GRAS
PfamPF035143.2E-109371742IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009410Biological Processresponse to xenobiotic stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 745 aa     Download sequence    Send to blast
MDPSFTEYSD FTNGSKIEKQ TSISNSNEYS VLSDEYTLNQ HSPYFDFIND YPNLFFPPDP  60
DPGNFMPSIN LSSLEEPSLP SSTLSPDGNS STPPSLSPGG DSSNDEKEFS IYVLKFINQI  120
LMEENMDEKP SSFNDPMSLQ VTEKSFYDAL GESYPYSTNQ SPTDDKAETP DSNFSVSSSD  180
YGSNSHDANS PQLLSDLGDH NSSLQSFVPG ENNFQFDLAT AQKFFRDSDS VSQFQRGFEE  240
ASKFLPKGNQ LIIDLESNGF SPQLKTDEAV VKTERESPPN GLRGRKNHER EDDDSEENRS  300
NKQSAQYIDE SELSEMFDKV LLQVDHRCDH SGETEPAQSE ASKALQPAES NANGKKGRGK  360
RQNKKKETVD LRTLLILCAQ AVSSDDRRTA YEILKQIRQH SSPNGDGSQR LAHFFANGLD  420
ARLAGIGTGA LFYSNLLANV KASDLLKAYH LNLSTCPFKK MAMFFANKMI MQVAEKATTL  480
HIVDFGILYG FQWPIFIQYL SKRDGGPPNL RITGIEFPQN GFRPKQRIEE TGRRLTKYCE  540
RFGVPFRYNA IATKNWDCIS VEDIEIESNE VVAVNCLMRF NNVLEETVEN CPRDAVLRLI  600
RKINPTIFVN NIVNGSYNAP FFVTRFRELM FHFSALLDML DTNVSKENEE RLMYEREFYG  660
REIVNVIACE GEDRVERPET YKQWHVRSLR AGFRSLPLDQ EIMGKFKDKL RTWYHKDFEI  720
DEDTNWMLQG WKGRIVYATS CWVPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-453757428374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009364377.10.0PREDICTED: scarecrow-like protein 14
RefseqXP_009364376.10.0PREDICTED: scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLW9S2B70.0W9S2B7_9R
STRINGPOPTR_0009s03800.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14